PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00101602001
Common NameGSBRNA2T00101602001, LOC106438304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 370aa    MW: 40525.4 Da    PI: 8.2552
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00101602001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.14e-3875136263
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                          ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg+++knk+sss
  GSBRNA2T00101602001  75 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSKKNKRSSS 136
                          6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2774126IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3277133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42579133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDATKWTQGF QDMMNVKPME QIMIPNNNTH QSNTTSDARP NTILTSNGVS AAGATVSGVS  60
NNNNTAVVVE RKARPQEKVN CPRCNSTNTK FCYYNNYSLT QPRYFCKGCR RYWTEGGSLR  120
NVPVGGSSKK NKRSSSSSNI LQATPSSVGL TTTLPDLNPP ILFSNQIPNK SKGSSHDLNL  180
LSFPVMQDQN HHHHGHMSQF LQMPKMEGNG NITHQQPSSL YGSSSSPVSA LELLRTGANV  240
SSRSGINSFM PSGPMLDSSN NVLYTSSGFP TMVDYKPSNL SFSTDHHQEM GHNHTSRSDD  300
HNDHHQGRIL FPFGDQMKEL TSSITQEVDH DDNQQQKTHG DNNNNNSSSS PNTGYWSGMF  360
NTTGGGSSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144940.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00101602001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324910.0AC232491.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049N04, complete sequence.
GenBankAC2410330.0AC241033.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045E05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013734873.10.0PREDICTED: dof zinc finger protein DOF2.5-like
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A078E3060.0A0A078E306_BRANA; BnaC03g25870D protein
STRINGBra000429.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.20.0Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]